PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA007168-PA
Common NameOsI_05764
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 719aa    MW: 75935.4 Da    PI: 6.4976
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA007168-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.31.5e-28481532152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek+++le+l+k+Fs+++kdAA++Lgvc+T++KriCRq+GI+RWP+Rki+++
  BGIOSGA007168-PA 481 AEKSVTLEELQKHFSGSLKDAARSLGVCPTTMKRICRQHGIPRWPFRKISKV 532
                       5899*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.598466552IPR003035RWP-RK domain
PfamPF020422.7E-26484532IPR003035RWP-RK domain
SuperFamilySSF542774.25E-18606678No hitNo description
SMARTSM006667.0E-17611707IPR000270PB1 domain
PROSITE profilePS5174515.469611707IPR000270PB1 domain
CDDcd064075.40E-30612694No hitNo description
PfamPF005643.9E-11612684IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.0E-21612678No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MVHEMKVFVC MRACAGGSEG GGGGSPGTEE AAAVAVKQRI ARALRLYKEA AGDGGGGWMV  60
QVWAPARDGA RRVLATRGQP FVLASQCHRL FQYRTVSLTR VFPVGGAAAA DEQGLPARAF  120
DATAPEWTPN VQCYGSGEYA RISYALIYDI QGSLALPILD PDDASSPLAV LELVTTAPLL  180
RVSGEVANLC NALRAVSLRG AGICNRAAEC YSLAVNQIVH RDATRAAMAE VSELLITVCE  240
AHKLPLAQTW VRCWSCGGGG EDTEKAALTT AGAPFHLAAG ADARGFRDAC VEHHLQRGQG  300
LVGTAARAPG GGRLCADVAR CSKDDYPLAH YAGMYGLAGC LVLRAELSAA AMADAAAATA  360
GDEEDCVVLE LFLPPDCTGV AEQKAAVDAV SATIKQCSGN LKAIVISNLD DLFLDTMADG  420
DHQLRHEMDD LGDDQRCSDE EDLQLLENTN IGELNIHNAD QIRNEDPTSQ VGKNKTKRGK  480
AEKSVTLEEL QKHFSGSLKD AARSLGVCPT TMKRICRQHG IPRWPFRKIS KVNRSLDKMK  540
RVMESVNCSP SPPVAMPAHP ALLLPPPPPP PRPCLSSTVG ETSSHGSCQA PPSHAKTALR  600
KPPRCGNGDG VVTIKASHRG DIIRFRVPCS AGVAAVKAVV AKRLSLDAGA FDVKYLDDDH  660
EWVLLSCDAD FQECLDVVPA LPSMSVTARS GSGAAAPVVV RLMVQEVADN IGSSCASSD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.797980.0leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2975985470.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0054740.0AP005474.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0081C13.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627710.10.0PREDICTED: protein NLP3-like
TrEMBLA2X0M80.0A2X0M8_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA007168-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62692939
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-106Nin-like family protein